PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009149316.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SRS
Protein Properties Length: 357aa    MW: 37176.8 Da    PI: 7.9449
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009149316.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF7022242.9e-691282774153
          DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa.aeaaskrkrelkskkqsalsstklssaesk 97 
                     ++asCqdCGnqakkdCah RCRtCCksrgfdC thv+stWvpaakrrerq+qla+ + ++ + + ++  +kr+re+  +++sal +t++++++++
  XP_009149316.1 128 NGASCQDCGNQAKKDCAHVRCRTCCKSRGFDCPTHVRSTWVPAAKRRERQHQLATVQPQTHQPRgDSGVPKRQRENLPATSSALVCTRIPTHNAS 222
                     4679**************************************************9988877766678889*********************9866 PP

          DUF702  98 keletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                       le+ ++P+ev s+avfrcvrvssv+dgeeelaYqtavsigGh+fkG+Lyd+G+ 
  XP_009149316.1 223 -GLEVGDFPTEVCSPAVFRCVRVSSVEDGEEELAYQTAVSIGGHIFKGVLYDKGPG 277
                     .9999*************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051425.9E-63129276IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016235.8E-27131173IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.5E-25229276IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010252Biological Processauxin homeostasis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048479Biological Processstyle development
GO:0048480Biological Processstigma development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MAGFFSLGGG GGGGGGGNSQ EEHRNPPPPV SEAWLWYRNP NTNANAPSSS NAALGTLELW  60
QNHNQQEIMF QHQQHQQRLD LYSSAAGLGV GPSNHSQFDI SGETSNAAAG RAAALMMMRS  120
GGSGGGGNGA SCQDCGNQAK KDCAHVRCRT CCKSRGFDCP THVRSTWVPA AKRRERQHQL  180
ATVQPQTHQP RGDSGVPKRQ RENLPATSSA LVCTRIPTHN ASGLEVGDFP TEVCSPAVFR  240
CVRVSSVEDG EEELAYQTAV SIGGHIFKGV LYDKGPGSSG GYNAIATGES SSGGGGGHQL  300
NLITAGSVTV ATASSSTPNA GRIGSSSAAS YNDPSSLYPT PINTFMAGTQ FFPNPRS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.301380.0root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00613PBMTransfer from AT3G51060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2052620.0GU205262.1 Brassica rapa subsp. pekinensis stylish (STY1-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009149316.10.0PREDICTED: protein SHI RELATED SEQUENCE 1-like
SwissprotQ9SD400.0SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLM4FCR10.0M4FCR1_BRARP; Uncharacterized protein
STRINGBra038880.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34192864
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.11e-142Lateral root primordium (LRP) protein-related